| request information: |
|
| Catalog Code: | H00027242-M08 |
| Product Name: | tumor necrosis factor receptor superfamily, member 21 Antibody |
| Product Description: | Mouse Monoclonal anti-tumor necrosis factor receptor superfamily, member 21 (1B2) |
| Clone: | 1B2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27242 |
| Gene Symbol: | TNFRSF21 |
| Omim ID: | 605732, |
| Immunogen: | TNFRSF21 (AAH05192, 1 a.a. ~ 125 a.a) full length recombinant protein with GST tag. |
| Epitope: | MQFNFELSFKYVLYSSYSWLKLDHTIADCMVFTWTPCRMLDYLYSSYANMLWAGEMKSSSHQDLLFKWLDNWATKELEL
HLLGFELFWNTLLHFGKSKSSASGALSIENLPSFALKDVLFFIYT* |
| Specificity: | tumor necrosis factor receptor superfamily, member 21 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-BM-018 antibody, anti-DR6 antibody, anti-MGC31965 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |