ExactAntigen

IL17B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00027190-M01
Product Type:Primary Antibody
Product Name:IL17B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:27190
Host:Mouse
Clone:6G5
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-IL17B (6G5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = IL17B PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-IL-17B antibody, anti-IL-20 antibody, anti-ZCYTO7 antibody
Immunogen:IL17B (NP_055258, 23 a.a. ~ 123 a.a) partial recombinant protein with GST tag.
Epitope:RSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCL* ...
Specificity:IL17B - interleukin 17B
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:IL17B
Omim ID:604627
see all human IL 17B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about