| request information: |
|
| Catalog Code: | H00027190-A01 |
| Product Name: | IL17B Antibody |
| Product Description: | Mouse Polyclonal anti-IL17B |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 27190 |
| Gene Symbol: | IL17B |
| Omim ID: | 604627 |
| Immunogen: | IL17B (NP_055258, 23 a.a. ~ 123 a.a) partial recombinant protein with GST tag. |
| Epitope: | RSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPW
GYSINHDPSRIPVDLPEARCL* |
| Specificity: | IL17B - interleukin 17B |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-IL-17B antibody, anti-IL-20 antibody, anti-ZCYTO7 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |