| request information: |
|
| Catalog Code: | H00027181-M03 |
| Product Name: | SIGLEC8 Antibody |
| Product Description: | Mouse Monoclonal anti-SIGLEC8 (3H1) |
| Clone: | 3H1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27181 |
| Gene Symbol: | SIGLEC8 |
| Omim ID: | 605639, |
| Immunogen: | SIGLEC8 (NP_055257, 18 a.a. ~ 122 a.a) partial recombinant protein with GST tag. |
| Epitope: | EGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRF
QLLGDIWSNDCSLSIRDARKRDKGS* |
| Specificity: | SIGLEC8 - sialic acid binding Ig-like lectin 8 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC59785 antibody, anti-SAF2 antibody, anti-SIGLEC-8 antibody, anti-SIGLEC8L antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |