| request information: |
|
| Catalog Code: | H00027158-A01 |
| Product Name: | NDOR1 Antibody |
| Product Description: | Mouse Polyclonal anti-NDOR1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 27158 |
| Gene Symbol: | NDOR1 |
| Omim ID: | 606073, |
| Immunogen: | NDOR1 (NP_055249, 498 a.a. ~ 596 a.a) partial recombinant protein with GST tag. |
| Epitope: | EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSP
DAAAYLARLQQTRRFQTET* |
| Specificity: | NDOR1 - NADPH dependent diflavin oxidoreductase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC138148 antibody, anti-NR1 antibody, anti-bA350O14.9 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |