| CatalogCode: | H00027132-A01 |
| ProductName: | CPNE7 Antibody |
| Product Description: | Mouse Polyclonal anti-CPNE7 |
| Clonality: | Polyclonal |
| Immunogen: | CPNE7 (NP_705900, 460 a.a. ~ 559 a.a) partial recombinant protein with GST tag. |
| Epitope: | ASRLPMSIIIVGVGNADFTDMQVLDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPGCTP* ... |
| Specificity: | CPNE7 - copine VII |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the copine family, which is composed of calcium-dependent membrane-binding proteins. The gene product contains two N-terminal C2 domains and one von Willebrand factor A domain. Sequence analysis identified two alternatively spliced transcript variants that encode different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MGC34192 antibody |
| ProteinTarget: | CPNE7 - copine VII |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 27132 |
| Gene_Symbol: | CPNE7 |
| Omim_ID: | 605689, |
order or
more information: | company product webpage |
| request information: |
|