| request information: |
|
| Catalog Code: | H00027130-A01 |
| Product Name: | INVS Antibody |
| Product Description: | Mouse Polyclonal anti-INVS |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 27130 |
| Gene Symbol: | INVS |
| Omim ID: | 243305, 602088, |
| Immunogen: | INVS (NP_055240, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. |
| Epitope: | MNKSENLLFAGSSLASQVHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDH
SQRTALHLAAQK* |
| Specificity: | INVS - inversin |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a protein containing multiple ankyrin domains and two IQ calmodulin-binding domains. The encoded protein may function in renal tubular development and function, and in left-right axis determination. This protein interacts with nephrocystin and infers a connection between primary cilia function and left-right axis determination. A similar protein in mice interacts with calmodulin. Mutations in this gene have been associated with nephronophthisis type 2. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-INV antibody, anti-KIAA0573 antibody, anti-MGC133080 antibody, anti-MGC133081 antibody, anti-NPH2 antibody, anti-NPHP2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |