| request information: |
|
| Catalog Code: | H00027094-M02 |
| Product Name: | potassium large conductance calcium-activated channel, subfamily M beta member 3 Antibody |
| Product Description: | Mouse Monoclonal anti-potassium large conductance calcium-activated channel, subfamily M beta member 3 (5H1) |
| Clone: | 5H1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27094 |
| Gene Symbol: | KCNMB3 |
| Omim ID: | 605222, |
| Immunogen: | KCNMB3 (NP_741979, 82 a.a. ~ 182 a.a) partial recombinant protein with GST tag. |
| Epitope: | FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQ
DRNDLLNSALDIKEFFDHKNG* |
| Specificity: | potassium large conductance calcium-activated channel, subfamily M beta member 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. At least four transcript variants encoding four different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KCNMB2 antibody, anti-KCNMBL antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |