| CatalogCode: | H00027094-A01 |
| ProductName: | KCNMB3 Antibody |
| Product Description: | Mouse Polyclonal anti-potassium large conductance calcium-activated channel, subfamily M beta member 3 |
| Clonality: | Polyclonal |
| Immunogen: | KCNMB3 (NP_741979, 82 a.a. ~ 182 a.a) partial recombinant protein with GST tag. |
| Epitope: | FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG* ... |
| Specificity: | potassium large conductance calcium-activated channel, subfamily M beta member 3 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera<br>Other applications have not been tested. |
| Background: | MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. At least four transcript variants encoding four different isoforms have been found for this gene. |
| ProductRef: | 1. Piwonska M, et al. Differential distribution of Ca2+-activated potassium channel b4 subunit in rat brain: immunolocalization of KCNMB4 in neuronal mitochondria. doi:10.1016/j.neuroscience.2008.01.050 |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-KCNMB2 antibody, anti-KCNMBL antibody, Anti-potassium large conductance calcium-activated channel, subfamily M beta member 3 antibody |
| ProteinTarget: | potassium large conductance calcium-activated channel, subfamily M beta member 3 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 27094 |
| Gene_Symbol: | potassium large conductance calcium-activated channel, subfamily M beta member 3 |
| Omim_ID: | 605222, |
order or
more information: | company product webpage |
| request information: |
|