| request information: |
|
| Catalog Code: | H00027087-A01 |
| Product Name: | beta-1,3-glucuronyltransferase 1 Antibody |
| Product Description: | Mouse Polyclonal anti-beta-1,3-glucuronyltransferase 1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 27087 |
| Gene Symbol: | B3GAT1 |
| Omim ID: | 151290, |
| Immunogen: | B3GAT1 (NP_061114, 235 a.a. ~ 333 a.a) partial recombinant protein with GST tag. |
| Epitope: | AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTR
TEKPVLVNEGKKGFTDPSV* |
| Specificity: | beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CD57 antibody, anti-GLCATP antibody, anti-GlcAT-P antibody, anti-GlcUAT-P antibody, anti-HNK-1 antibody, anti-LEU7 antibody, anti-NK-1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |