| request information: |
|
| Catalog Code: | H00027040-M01 |
| Product Name: | LAT Antibody |
| Product Description: | Mouse Monoclonal anti-LAT (3B11-1D5) |
| Clone: | 3B11-1D5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27040 |
| Gene Symbol: | LAT |
| Omim ID: | 602354 |
| Immunogen: | LAT (AAH11563, 1 a.a. ~ 234 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLL
PIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGI
RDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN* |
| Specificity: | LAT - linker for activation of T cells |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-36 kDa phospho tyrosine adapter protein antibody, anti-LAT antibody, anti-Linker for Activation of T cells antibody, anti-p36 38 antibody, anti-pp36 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |