| request information: |
|
| Catalog Code: | H00027037-M01 |
| Product Name: | HTF9C Antibody |
| Product Description: | Mouse Monoclonal anti-HTF9C (4B3-1B1) |
| Clone: | 4B3-1B1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27037 |
| Gene Symbol: | HTF9C |
| Immunogen: | HTF9C (AAH13352, 1 a.a. ~ 626 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLYSYIRDDLFTSEIFKLELQN
VPRHASFSDVRRFLGRFGLQPHKTKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGRPLSVRLARPKADPMARRRRQE
GESEPPVTRVADVVTPLWTVPYAEQLERKQLECEQVLQKLAKEIGSTNRALLPWLLEQRHKHNKACCPLEGVRPSPQQT
EYRNKCEFLVGVGVDGED |
| Specificity: | HTF9C - HpaII tiny fragments locus 9C |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |