| Catalog Code: | H00027036-B01 |
| Product Type: | Primary Antibody |
| Product Name: | SIGLEC7 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 27036 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-SIGLEC7 - sialic acid binding Ig-like lectin 7, MaxPab Antibody |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Alternate Names: | anti-AIRM1 antibody, anti-QA79 antibody, anti-SIGLEC-7 antibody, anti-p75 antibody, anti-p75/AIRM1 antibody |
| Immunogen: | SIGLEC7 (-, 1 a.a. ~ 467 a.a) full-length human protein. |
| Epitope: | MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTAS ... |
| Preservative: | No Preservative |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Application Summary: | Western Blot 1:500, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |