| request information: |
|
| Catalog Code: | H00027018-B01 |
| Product Name: | NGFRAP1 Antibody |
| Product Description: | Mouse Polyclonal anti-NGFRAP1 - nerve growth factor receptor (TNFRSF16) associated protein 1, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 27018 |
| Gene Symbol: | NGFRAP1 |
| Immunogen: | NGFRAP1 (NP_996800, 1 a.a. ~ 101 a.a) full-length human protein. |
| Epitope: | MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNC
LRILMGELSNHHDHHDEFCLMP |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BEX3 antibody, anti-Bex antibody, anti-DXS6984E antibody, anti-HGR74 antibody, anti-NADE antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |