ExactAntigen

Mouse Monoclonal anti-AATF (2H6) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00026574-M09
ProductName: AATF Antibody
Product Description: Mouse Monoclonal anti-AATF (2H6)
Clone: 2H6
Clonality: Monoclonal
Immunogen: AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Epitope: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT ...
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: protein A purified
Host_Name: Mouse
Buffer: 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CHE-1 antibody, anti-CHE1 antibody, anti-DED antibody
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 26574
Gene_Symbol: AATF
Omim_ID: 608463,
more information: company product webpage
Also see:
see all human AATF antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about