| CatalogCode: | | H00026574-M09 |
| ProductName: | | AATF Antibody |
| Product Description: | | Mouse Monoclonal anti-AATF (2H6) |
| Clone: | | 2H6 |
| Clonality: | | Monoclonal |
| Immunogen: | | AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. |
| Epitope: | | VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT ... |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | | The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | protein A purified |
| Host_Name: | | Mouse |
| Buffer: | | 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CHE-1 antibody, anti-CHE1 antibody, anti-DED antibody |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 26574 |
| Gene_Symbol: | | AATF |
| Omim_ID: | | 608463, |
| more information: | | company product webpage |