ExactAntigen

AATF Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00026574-M04
Product Type:Primary Antibody
Product Name:AATF Antibody
List Price:275
Clonality:Monoclonal
Gene ID:26574
Host:Mouse
Clone:3C7
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-AATF - apoptosis antagonizing transcription factor (3C7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of tra
Alternate Names:anti-CHE-1 antibody, anti-CHE1 antibody, anti-DED antibody
Immunogen:AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Epitope:VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:AATF
see all human AATF antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about