| Catalog Code: | H00026574-M04 |
| Product Type: | Primary Antibody |
| Product Name: | AATF Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 26574 |
| Host: | Mouse |
| Clone: | 3C7 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-AATF - apoptosis antagonizing transcription factor (3C7) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of tra |
| Alternate Names: | anti-CHE-1 antibody, anti-CHE1 antibody, anti-DED antibody |
| Immunogen: | AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. |
| Epitope: | VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is |
| Gene Symbol: | AATF |