| CatalogCode: | H00026509-A01 |
| ProductName: | FER1L3 Antibody |
| Product Description: | Mouse Polyclonal anti-FER1L3 |
| Clonality: | Polyclonal |
| Immunogen: | FER1L3 (NP_038479, 655 a.a. ~ 755 a.a) partial recombinant protein with GST tag. |
| Epitope: | DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI* ... |
| Specificity: | FER1L3 - fer-1-like 3, myoferlin (C. elegans) |
| CrossReactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length natures have not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MYOF antibody, anti-FLJ36571 antibody, anti-FLJ90777 antibody, anti-fer-1-like 3, myoferlin (C. elegans) antibody |
| ProteinTarget: | FER1L3 - fer-1-like 3, myoferlin (C. elegans) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 26509 |
| Gene_Symbol: | FER1L3 |
| Omim_ID: | 604603, |