| request information: |
|
| Catalog Code: | H00026508-M16 |
| Product Name: | HEYL Antibody |
| Product Description: | Mouse Monoclonal anti-HEYL (3B11) |
| Clone: | 3B11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 26508 |
| Gene Symbol: | HEYL |
| Omim ID: | 609034, |
| Immunogen: | HEYL (NP_055386, 1 a.a. ~ 70 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |