| request information: |
|
| Catalog Code: | H00026502-M03 |
| Product Name: | NARF Antibody |
| Product Description: | Mouse Monoclonal anti-NARF (7D9) |
| Clone: | 7D9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 26502 |
| Gene Symbol: | NARF |
| Omim ID: | 605349, |
| Immunogen: | NARF (1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRV
LNLNKKCDTSKHKVLVVSVCP* |
| Specificity: | NARF - nuclear prelamin A recognition factor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for western blot. |
| Background: | Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. The protein encoded by this gene binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. The encoded protein is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, including one with a novel exon that is generated by RNA editing. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgM Kappa |
| Host Name: | Mouse |
| Application Summary: | Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp434G0420 antibody, anti-FLJ10067 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |