ExactAntigen

GNL3 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00026354-M10
Product Name:GNL3 Antibody
Product Description:Mouse Monoclonal anti-GNL3 (2B9)
Clone:2B9
Clonality:Monoclonal
ListPrice:295
Gene ID:26354
Gene Symbol:GNL3
Omim ID:608011,
Immunogen:GNL3 (AAH01024, 328 a.a. ~ 427 a.a) full length recombinant protein with GST tag.
Epitope:IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPP
TSWTPPPYFNESIVVDMKSGF
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-C77032 antibody, anti-E2IG3 antibody, anti-MGC800 antibody, anti-NS antibody
Package Size:0.1 mg
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human nucleostemin antibodies


2008©ExactAntigen home | browse | about