| request information: |
|
| Catalog Code: | H00026354-M10 |
| Product Name: | GNL3 Antibody |
| Product Description: | Mouse Monoclonal anti-GNL3 (2B9) |
| Clone: | 2B9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 26354 |
| Gene Symbol: | GNL3 |
| Omim ID: | 608011, |
| Immunogen: | GNL3 (AAH01024, 328 a.a. ~ 427 a.a) full length recombinant protein with GST tag. |
| Epitope: | IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPP
TSWTPPPYFNESIVVDMKSGF |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-C77032 antibody, anti-E2IG3 antibody, anti-MGC800 antibody, anti-NS antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |