| request information: |
|
| Catalog Code: | H00026330-M01 |
| Product Name: | GAPDS Antibody |
| Product Description: | Mouse Monoclonal anti-GAPDS (2E3-2E10) |
| Clone: | 2E3-2E10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 26330 |
| Gene Symbol: | GAPDHS |
| Omim ID: | 609169 |
| Immunogen: | GAPDS (AAH36373, 1 a.a. ~ 409 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMVSVARELTVG
INGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPW
RAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIH
ERFGIVEGLMTTVHSYTA |
| Specificity: | GAPDHS - glyceraldehyde-3-phosphate dehydrogenase, spermatogenic |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. Like its somatic cell counterpart, this sperm-specific enzyme functions in a nicotinamide adenine dinucleotide-dependent manner to remove hydrogen and add phosphate to glyceraldehyde 3-phosphate to form 1,3-diphosphoglycerate. During spermiogenesis, this enzyme may play an important role in regulating the switch between different energy-producing pathways, and it is required for sperm motility and male fertility. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GAPD2 antibody, anti-GAPDH-2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | 1. Davis BN, Hilyard AC, Lagna G, Hata A. SMAD proteins control DROSHA-mediated microRNA maturation. Nature. 2008 Jun 11. |
order or
more information: | company product webpage |