| request information: |
|
| Catalog Code: | H00026297-M01 |
| Product Name: | DELGEF Antibody |
| Product Description: | Mouse Monoclonal anti-DELGEF (1A2) |
| Clone: | 1A2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 26297 |
| Gene Symbol: | DELGEF |
| Omim ID: | 606051, |
| Immunogen: | DELGEF (NP_036271, 240 a.a. ~ 338 a.a) partial recombinant protein with GST tag. |
| Epitope: | KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPC
SRPPNSMPSSPHCLTGATE* |
| Specificity: | DELGEF - deafness locus associated putative guanine nucleotide exchange factor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |