ExactAntigen

Mouse Polyclonal anti-DELGEF | Novus Biologicals antibody product information
CatalogCode:H00026297-A01
ProductName:DELGEF Antibody
Product Description:Mouse Polyclonal anti-DELGEF
Clonality:Polyclonal
Immunogen:DELGEF (NP_036271, 240 a.a. ~ 338 a.a) partial recombinant protein with GST tag.
Epitope:KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE* ...
Specificity:DELGEF - deafness locus associated putative guanine nucleotide exchange factor
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ProteinTarget:DELGEF - deafness locus associated putative guanine nucleotide exchange factor
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:26297
Gene_Symbol:DELGEF
Omim_ID:606051,
order or
more information
:
company product webpage
request information:
Also see:
all human SERGEF antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about