| Catalog Code: | H00026291-M04 |
| Product Type: | Primary Antibody |
| Product Name: | FGF21 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 26291 |
| Host: | Mouse |
| Clone: | 3A6 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-FGF21 (3A6) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell |
| Immunogen: | FGF21 (AAH18404, 30 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. |
| Epitope: | PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS* ... |
| Specificity: | FGF21 - fibroblast growth factor 21 |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FGF21 |
| Omim ID: | 609436, |