| request information: | |
| Catalog Code: | H00026291-M02 |
| Product Name: | FGF21 Antibody |
| Product Description: | Mouse Monoclonal anti-FGF21 (1A8) |
| Clone: | 1A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 26291 |
| Gene Symbol: | FGF21 |
| Omim ID: | 609436, |
| Immunogen: | FGF21 (AAH18404, 30 a.a. ~ 210 a.a) full length recombinant protein with GST tag. |
| Epitope: | PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPD VGSSDPLSMVGPSQGRSPSYAS* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |