| request information: |
|
| Catalog Code: | H00026277-A01 |
| Product Name: | TINF2 Antibody |
| Product Description: | Mouse Polyclonal anti-TINF2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 26277 |
| Gene Symbol: | TINF2 |
| Omim ID: | 604319, |
| Immunogen: | TINF2 (NP_036593, 256 a.a. ~ 355 a.a) partial recombinant protein with GST tag. |
| Epitope: | RHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISNPESKEEHAIYTADLAMGTRAPSNGKYKGPYQT
LGGRALKENPVDLPATEQKE* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant TINF2. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TIN2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |