| request information: |
|
| Catalog Code: | H00026271-A01 |
| Product Name: | FBXO5 Antibody |
| Product Description: | Mouse Polyclonal anti-FBXO5 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 26271 |
| Gene Symbol: | FBXO5 |
| Omim ID: | 606013 |
| Immunogen: | FBXO5 (NP_036309, 358 a.a. ~ 447 a.a) partial recombinant protein with GST tag. |
| Epitope: | RHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPG
TKKSKKNLRR* |
| Specificity: | FBXO5 - F-box protein 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is similar to xenopus early mitotic inhibitor-1 (Emi1), which is a mitotic regulator that interacts with Cdc20 and inhibits the anaphase promoting complex. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EMI1 antibody, anti-FBX5 antibody, anti-Fbxo31 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |