ExactAntigen

Mouse Polyclonal anti-FBXO8 | Novus Biologicals antibody product information
CatalogCode:H00026269-A01
ProductName:FBXO8 Antibody
Product Description:Mouse Polyclonal anti-FBXO8
Clonality:Polyclonal
Immunogen:FBXO8 (NP_036312, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag.
Epitope:MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLPPE* ...
Specificity:FBXO8 - F-box protein 8
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It contains a C-terminal amino acid sequence that bears a significant similarity with a portion of yeast Sec7p, a critical regulator of vesicular protein transport. This human protein may interact with ADP-ribosylation factor(s)(ARFs) and exhibit ARF-GEF (guanine nucleotide exchange factor) activity.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-DC10 antibody, anti-FBS antibody, anti-FBX8 antibody
ProteinTarget:FBXO8 - F-box protein 8
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:26269
Gene_Symbol:FBXO8
Omim_ID:605649 H00026269-M01
order or
more information
:
company product webpage
request information:
Also see:
all human FBXO8 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about