| request information: |
|
| Catalog Code: | H00026259-A01 |
| Product Name: | FBXW8 Antibody |
| Product Description: | Mouse Polyclonal anti-FBXW8 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 26259 |
| Gene Symbol: | FBXW8 |
| Omim ID: | 609073 |
| Immunogen: | FBXW8 (NP_699179, 499 a.a. ~ 599 a.a) partial recombinant protein with GST tag. |
| Epitope: | VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRS
SCDAMATHYYDLALAFPYNHV* |
| Specificity: | FBXW8 - F-box and WD-40 domain protein 8 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FBW6 antibody, anti-FBW8 antibody, anti-FBX29 antibody, anti-FBXO29 antibody, anti-MGC33534 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Novus References: | 1. Wei S, Yang H-C, Chuang H-C, et al. A novel mechanism by which thiazolidinediones facilitate the proteasomal degradation of cyclin D1 in cancer cells. J Biol Chem 2008:M802160200. |
order or
more information: | company product webpage |