ExactAntigen

kelch-like 3 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00026249-A01
Product Name:kelch-like 3 Antibody
Product Description:Mouse Polyclonal anti-kelch-like 3
Clonality:Polyclonal
ListPrice:225
Gene ID:26249
Gene Symbol:KLHL3
Omim ID:605775,
Immunogen:KLHL3 (NP_059111, 1 a.a. ~ 66 a.a) partial recombinant protein with GST tag.
Epitope:MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHR*
Specificity:kelch-like 3 (Drosophila)
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-KIAA1129 antibody, anti-MGC44594 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human KLHL3 antibodies


2008©ExactAntigen home | browse | about