| request information: |
|
| Catalog Code: | H00026235-A01 |
| Product Name: | FBXL4 Antibody |
| Product Description: | Mouse Polyclonal anti-FBXL4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 26235 |
| Gene Symbol: | FBXL4 |
| Omim ID: | 605654 |
| Immunogen: | FBXL4 (NP_036292, 524 a.a. ~ 620 a.a) partial recombinant protein with GST tag. |
| Epitope: | CFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDNRA
VLELNASFPKVFIKKSF* |
| Specificity: | FBXL4 - F-box and leucine-rich repeat protein 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least 9 tandem leucine-rich repeats. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FBL4 antibody, anti-FBL5 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |