| CatalogCode: | H00026227-M01 |
| ProductName: | PHGDH Antibody |
| Product Description: | Mouse Monoclonal anti-PHGDH (4A3-1D6) |
| Clone: | 4A3-1D6 |
| Clonality: | Monoclonal |
| Immunogen: | PHGDH (AAH11262, 1 a.a. ~ 534 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCA ... |
| Specificity: | PHGDH - phosphoglycerate dehydrogenase |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates and also tissue lysates. It has also been successfully used in immunofluroescence and immunohistochemistry on paraffin sections. |
| Background: | 3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IF, IHC-P |
| SpeciesSummary: | Hu |
| ALTnames: | anti-3-PGDH antibody, anti-3PGDH antibody, anti-MGC3017 antibody, anti-PDG antibody, anti-PGAD antibody, anti-PGD antibody, anti-PGDH antibody, anti-SERA antibody |
| ProteinTarget: | PHGDH - phosphoglycerate dehydrogenase |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 26227 |
| Gene_Symbol: | PHGDH |
| Omim_ID: | 601,815,606,879 H00026227-B01 |
order or
more information: | company product webpage |
| request information: |
|