| request information: |
|
| Catalog Code: | H00026225-A01 |
| Product Name: | ARL5 Antibody |
| Product Description: | Mouse Polyclonal anti-ARL5 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 26225 |
| Gene Symbol: | ARL5A |
| Omim ID: | 608960 |
| Immunogen: | ARL5 (AAH01254, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNT
YYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACC
ALTGEGLCQGLEWMMSRLKIR* |
| Specificity: | ARL5A - ADP-ribosylation factor-like 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |