| CatalogCode: | H00026191-M01 |
| ProductName: | PTPN22 Antibody |
| Product Description: | Mouse Monoclonal anti-PTPN22 (4F6) |
| Clone: | 4F6 |
| Clonality: | Monoclonal |
| Immunogen: | PTPN22 (AAH17785, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. |
| Epitope: | MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein tyrosine phosphatase which is expressed primarily in lymphoid tissues. This enzyme associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-LYP antibody, anti-Lyp1 antibody, anti-Lyp2 antibody, anti-PEP antibody, anti-PTPN8 antibody |
| ProteinTarget: | protein tyrosine phosphatase, non-receptor type 22 (lymphoid) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 26191 |
| Gene_Symbol: | PTPN22 |
| Omim_ID: | 152700, 180300, 222100, 600716, |
order or
more information: | company product webpage |
| request information: |
|