ExactAntigen

PRPF31 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00026121-A01
Product Type:Primary Antibody
Product Name:PRPF31 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:26121
Host:Mouse
Product Description:Mouse Polyclonal anti-PRPF31
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 26121 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-NY-BR-99 antibody, anti-PRP31 antibody, anti-PRP31 pre-mRNA processing factor 31 homolog (yeast) antibody, anti-RP11 antibody
Immunogen:PRPF31 (NP_056444, 400 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Epitope:GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST* ...
Specificity:PRPF31 - PRP31 pre-mRNA processing factor 31 homolog (yeast)
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PRPF31
Omim ID:600138, 606419,
see all human PRPF31 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about