| request information: |
|
| Catalog Code: | H00026119-M01 |
| Product Name: | LDLRAP1 Antibody |
| Product Description: | Mouse Monoclonal anti-LDLRAP1 (4G4-D5) |
| Clone: | 4G4-D5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 26119 |
| Gene Symbol: | LDLRAP1 |
| Omim ID: | 603,813,605,747 |
| Immunogen: | LDLRAP1 (AAH29770, 1 a.a. ~ 264 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKM
HDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPL
KSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMH
YAQCLSPVDWDKPDSSGT |
| Specificity: | LDLRAP1 - low density lipoprotein receptor adaptor protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ARH antibody, anti-ARH2 antibody, anti-DKFZp586D0624 antibody, anti-FHCB1 antibody, anti-FHCB2 antibody, anti-MGC34705 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | Autosomal recessive hypercholesterolemia in Spanish kindred due to a large deletion in the ARH gene.Quagliarini F, Arca M. et al. Mol Genet Metab. 2007 Aug 6; [Epub ahead of print] |
order or
more information: | company product webpage |