| CatalogCode: | H00026119-A01 |
| ProductName: | LDLRAP1 Antibody |
| Product Description: | Mouse Polyclonal anti-LDLRAP1 |
| Clonality: | Polyclonal |
| Immunogen: | LDLRAP1 (AAH29770, 1 a.a. ~ 264 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGT ... |
| Specificity: | LDLRAP1 - low density lipoprotein receptor adaptor protein 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ARH antibody, anti-ARH2 antibody, anti-DKFZp586D0624 antibody, anti-FHCB1 antibody, anti-FHCB2 antibody, anti-MGC34705 antibody |
| ProteinTarget: | LDLRAP1 - low density lipoprotein receptor adaptor protein 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 26119 |
| Gene_Symbol: | LDLRAP1 |
| Omim_ID: | 603813 605747 |
order or
more information: | company product webpage |
| request information: |
|