| request information: |
|
| Catalog Code: | H00025988-A01 |
| Product Name: | MIZF Antibody |
| Product Description: | Mouse Polyclonal anti-MIZF |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 25988 |
| Gene Symbol: | MIZF |
| Omim ID: | 607099 |
| Immunogen: | MIZF (NP_056332, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEEEEEEEEDDPLEEEFSCLWQECGFCSLDSS
ADLIRHVYFHCYHTKLKQWGLQALQSQADLG* |
| Specificity: | MIZF - MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | MIZF interacts with methyl-CpG-binding protein-2 (MBD2; MIM 603547), a component of the MeCP1 histone deacetylase (HDAC) complex, and plays a role in DNA methylation and transcription repression.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZP434F162 antibody, anti-HiNF-P antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |