| request information: |
|
| Catalog Code: | H00025870-A01 |
| Product Name: | SUMF2 Antibody |
| Product Description: | Mouse Polyclonal anti-SUMF2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 25870 |
| Gene Symbol: | SUMF2 |
| Omim ID: | 607940, |
| Immunogen: | SUMF2 (NP_056226, 26 a.a. ~ 126 a.a) partial recombinant protein with GST tag. |
| Epitope: | QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDEL
RNKATQPMKSVLWWLPVEKAF* |
| Specificity: | SUMF2 - sulfatase modifying factor 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp66I1024 antibody, anti-MGC99485 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |