| request information: |
|
| Catalog Code: | H00025837-M01 |
| Product Name: | RAB26 Antibody |
| Product Description: | Mouse Monoclonal anti-RAB26 (2H1) |
| Clone: | 2H1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 25837 |
| Gene Symbol: | RAB26 |
| Omim ID: | 605455 |
| Immunogen: | RAB26 (NP_055168, 157 a.a. ~ 255 a.a) partial recombinant protein with GST tag. |
| Epitope: | AWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKE YGLPFMETSAKTGLNVDLAFTAIAKELKQRSMKAPSEPRFRL HDYVKREGRGASCC* |
| Specificity: | RAB26 - RAB26, member RAS oncogene family |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cell membrane; Lipid-anchor; Cytoplasmic side |
| Background: | Participates in exocrine secretion: regulates the secretion of acinar granules in the parotid gland |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate Buffered Saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-V46133 antibody, anti-Ras related protein Rab 26 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |