| request information: |
|
| Catalog Code: | H00025806-B01 |
| Product Name: | VAX2 Antibody |
| Product Description: | Mouse Polyclonal anti-VAX2 - ventral anterior homeobox 2, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 25806 |
| Gene Symbol: | VAX2 |
| Immunogen: | VAX2 (1 a.a. ~ 290 a.a) full-length human protein. |
| Epitope: | MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRESGADSDGQPGPGEADHCRRI
LVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQK
KDQSRDLEKRASSSASEAFATSNILRLLEQGRLLSVPRAPSLLALTPSLPGLPASHRGTSLGDPRNSSPRLNPLSSASA
SPPLPPPLPAVCFSSAPL |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | VAX2 gene was named based on its high seqeunce similarity to VAX1 gene and is almost exclusively expressed in the ventral portion of the retina during development. It may play an important role in morphogenetic processes underlying the correct development of the eye, particularly in the establishment of a correct dorsoventral pattern. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-DRES93 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |