ExactAntigen

SPDEF Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00025803-M01
Product Type:Primary Antibody
Product Name:SPDEF Antibody
List Price:275
Clonality:Monoclonal
Gene ID:25803
Host:Mouse
Clone:4A5
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-SPDEF (4A5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = SPDEF PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-PDEF antibody, anti-RP11-375E1__A.3 antibody, anti-bA375E1.3 antibody
Immunogen:SPDEF (NP_036523, 92 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Epitope:QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD* ...
Specificity:SPDEF - SAM pointed domain containing ets transcription factor
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SPDEF
Omim ID:608144,
see all human SPDEF antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about