| request information: |
|
| Catalog Code: | H00025803-A01 |
| Product Name: | SPDEF Antibody |
| Product Description: | Mouse Polyclonal anti-SPDEF |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 25803 |
| Gene Symbol: | SPDEF |
| Omim ID: | 608144 |
| Immunogen: | SPDEF (AAH21299, 1 a.a. ~ 336 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPG
ASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
LLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTD
SEVDSSCSGQPIHLWQFL |
| Specificity: | SPDEF - SAM pointed domain containing ets transcription factor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PDEF antibody, anti-RP11-375E1__A.3 antibody, anti-bA375E1.3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |