| request information: |
|
| Catalog Code: | H00024140-B01 |
| Product Name: | FTSJ1 Antibody |
| Product Description: | Mouse Polyclonal anti-FTSJ1 - FtsJ homolog 1 (E. coli), MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 24140 |
| Gene Symbol: | FTSJ1 |
| Immunogen: | FTSJ1 (AAH23584, 1 a.a. ~ 330 a.a) full-length human protein. |
| Epitope: | MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAM
APLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIF
RGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVT
CGDLSSYDSDRSYPLDLE |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate in western blot. GST tag alone is used as a negative control. May also be used for immunofluorescence and ELISA. |
| Background: | The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA, immunofluorescence |
| Species Summary: | Hu |
| Alternate Names: | anti-CDLIV antibody, anti-JM23 antibody, anti-MRX44 antibody, anti-MRX9 antibody, anti-SPB1 antibody, anti-TRM7 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |