| request information: |
|
| Catalog Code: | H00023683-M01 |
| Product Name: | PRKD3 Antibody |
| Product Description: | Mouse Monoclonal anti-PRKD3 (4G7) |
| Clone: | 4G7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23683 |
| Gene Symbol: | PRKD3 |
| Omim ID: | 607077 |
| Immunogen: | Partial recombinant protein with GST tag, between amino acids 1-100 [NCBI#AAH30706]. |
| Epitope: | MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQE
LSLSAVKDLVCSIVYQKFPEC |
| Cross Reactivity: | Human. Other species have not been tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | This antibody is reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasm, nucleus. |
| Background: | Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role. The protein encoded by this gene is one of the PKC family members. This kinase can be activated rapidly by the agonists of G protein-coupled receptors. It resides in both cytoplasm and nucleus, and its nuclear accumulation is found to be dramatically enhanced in response to its activation. This kinase can also be activated after B-cell antigen receptor (BCR) engagement, which requires intact phopholipase C gamma and the involvement of other PKC family members. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Buffer: | PBS, [pH7.2] |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-Protein kinase D3 antibody, anti-EPK2 antibody, anti-PKC-NU antibody, anti-PKD3 antibody, anti-PRKCN antibody, anti-nPKC-NU antibody |
| Package Size: | 0.1 mg |
order or
more information: | company product webpage |