| request information: |
|
| Catalog Code: | H00023678-M02 |
| Product Name: | SGKL Antibody |
| Product Description: | Mouse Monoclonal anti-SGKL (2A7) |
| Clone: | 2A7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23678 |
| Gene Symbol: | SGK3 |
| Omim ID: | 607591 |
| Immunogen: | SGKL (AAH15326, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. |
| Epitope: | MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFG
DNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSE |
| Specificity: | SGK3 - serum/glucocorticoid regulated kinase-like |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CISK antibody, anti-DKFZp781N0293 antibody, anti-SGK2 antibody, anti-SGK3 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |