| CatalogCode: | | H00023678-M01 |
| ProductName: | | SGKL Antibody |
| Product Description: | | Mouse Monoclonal anti-SGKL (3A5-1A8) |
| Clone: | | 3A5-1A8 |
| Clonality: | | Monoclonal |
| Immunogen: | | SGKL (AAH15326, 1 a.a. ~ 497 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRE ... |
| Specificity: | | SGK3 - serum/glucocorticoid regulated kinase-like |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CISK antibody, anti-DKFZp781N0293 antibody, anti-SGK2 antibody, anti-SGK3 antibody |
| ProteinTarget: | | SGK3 - serum/glucocorticoid regulated kinase-like |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 23678 |
| Gene_Symbol: | | SGK3 |
| Omim_ID: | | 607591 H00023678-M02 |
| more information: | | company product webpage |