ExactAntigen

Mouse Monoclonal anti-SGKL (3A5-1A8) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00023678-M01
ProductName: SGKL Antibody
Product Description: Mouse Monoclonal anti-SGKL (3A5-1A8)
Clone: 3A5-1A8
Clonality: Monoclonal
Immunogen: SGKL (AAH15326, 1 a.a. ~ 497 a.a) full length recombinant protein with GST tag.
Epitope: MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRE ...
Specificity: SGK3 - serum/glucocorticoid regulated kinase-like
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CISK antibody, anti-DKFZp781N0293 antibody, anti-SGK2 antibody, anti-SGK3 antibody
ProteinTarget: SGK3 - serum/glucocorticoid regulated kinase-like
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 23678
Gene_Symbol: SGK3
Omim_ID: 607591 H00023678-M02
more information: company product webpage
Also see:
see all human SGK3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about