| Catalog Code: | H00023677-M11 |
| Product Type: | Primary Antibody |
| Product Name: | SH3BP4 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 23677 |
| Host: | Mouse |
| Clone: | 2B6 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-SH3BP4 - SH3-domain binding protein 4 (2B6) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, speci |
| Alternate Names: | anti-BOG25 antibody, anti-TTP antibody |
| Immunogen: | SH3BP4 (AAH57396, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is |
| Gene Symbol: | SH3BP4 |