ExactAntigen

SH3BP4 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00023677-M11
Product Type:Primary Antibody
Product Name:SH3BP4 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:23677
Host:Mouse
Clone:2B6
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-SH3BP4 - SH3-domain binding protein 4 (2B6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, speci
Alternate Names:anti-BOG25 antibody, anti-TTP antibody
Immunogen:SH3BP4 (AAH57396, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:SH3BP4
see all human SH3BP4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about