| request information: |
|
| Catalog Code: | H00023677-M01 |
| Product Name: | SH3BP4 Antibody |
| Product Description: | Mouse Monoclonal anti-SH3BP4 (3F3) |
| Clone: | 3F3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23677 |
| Gene Symbol: | SH3BP4 |
| Omim ID: | 605611 |
| Immunogen: | SH3BP4 (AAH57396, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKG
DHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ |
| Specificity: | SH3BP4 - SH3-domain binding protein 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BOG25 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |