| request information: |
|
| Catalog Code: | H00023648-M01 |
| Product Name: | SSBP3 Antibody |
| Product Description: | Mouse Monoclonal anti-SSBP3 (3E6) |
| Clone: | 3E6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23648 |
| Gene Symbol: | SSBP3 |
| Omim ID: | 607390 |
| Immunogen: | SSBP3 (NP_060540, 1 a.a. ~ 103 a.a) partial recombinant protein with GST tag. |
| Epitope: | MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDT
CEHSSEAKAFHDYSAAAAPSPVL* |
| Specificity: | SSBP3 - single stranded DNA binding protein 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CSDP antibody, anti-FLJ10355 antibody, anti-SSDP antibody, anti-SSDP1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | Gungor, C.,et al. Proteasomal selection of multiprotein complexes recruited by LIM homeodomain transcription factors. Proc Natl Acad Sci U S A. 2007 Sep 18;104(38):15000-5. Epub 2007 Sep 11. |
order or
more information: | company product webpage |